SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019506 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019506
Domain Number 1 Region: 277-385
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-25
Family SH2 domain 0.000000557
Further Details:      
 
Domain Number 2 Region: 389-429
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000327
Family SOCS box-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019506   Gene: ENSMPUG00000019634   Transcript: ENSMPUT00000019786
Sequence length 441
Comment pep:novel scaffold:MusPutFur1.0:GL896900.1:9226937:9228262:1 gene:ENSMPUG00000019634 transcript:ENSMPUT00000019786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENSESISKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKNESCSDAETVNAVEKTEV
PLRSQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSGRHSSGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPINSKSSEWVSTDSSQSELRDGQLKQRR
NVEEEVNCFSQTNVQPCVITTNSASSCRGGPMTGSVMNLLSNNSIEDSDMDSDDEIITLC
TSSRKRNKPKWEMDEEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEA
LLEGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDIT
GLLEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLY
LKEYHYKSKVRVLRIDAPEQC
Download sequence
Identical sequences M3Z7E3
XP_004738877.1.14098 ENSMPUP00000019506 ENSMPUP00000019506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]