SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019796 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019796
Domain Number 1 Region: 370-474
Classification Level Classification E-value
Superfamily SH2 domain 6.33e-26
Family SH2 domain 0.00000133
Further Details:      
 
Domain Number 2 Region: 482-523
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000981
Family SOCS box-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019796   Gene: ENSMPUG00000019927   Transcript: ENSMPUT00000020079
Sequence length 536
Comment pep:known scaffold:MusPutFur1.0:GL896935.1:9924230:9925840:1 gene:ENSMPUG00000019927 transcript:ENSMPUT00000020079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKVGKMWNNFKYRCQNLFSHEGGSRSENVDMNSNRCLSVKERNISTGDSAPQQQSSPLR
ENVALQLGLSPSKNSSRRNQNCATEIPQIVEISIEKDNDSCVTPGARLARRDSYSRHAPW
GGKKKHSCSTKTQSSLDTDKKFSRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQR
LQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEVSGDSSAIPQANCDSEEDTTTLCLQSRRQKQRQVSGDSHAHVSRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
Download sequence
Identical sequences M3Z883
ENSMPUP00000019796 XP_004753062.1.14098 XP_004753063.1.14098 ENSMPUP00000019796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]