SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000343 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000343
Domain Number 1 Region: 880-1016
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.09e-19
Family cAMP-binding domain 0.012
Further Details:      
 
Domain Number 2 Region: 631-745
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000018
Family Voltage-gated potassium channels 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000343   Gene: ENSMPUG00000000348   Transcript: ENSMPUT00000000350
Sequence length 1155
Comment pep:novel scaffold:MusPutFur1.0:GL896978.1:6660912:6746623:1 gene:ENSMPUG00000000348 transcript:ENSMPUT00000000350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLNSSLSNSTLTSGLSNTWQEFFSSTFMTASEDLPKIILILSLVCTVGAFLNLHLKDFP
VPFPVILFLIGCSFEILSFTSVQVQIYADAIQWMSPKIFFDLFTPIIIFNVAFDMDVYIV
QKLFWQVLLITIPGFVMNYILILWYLASVDKLLLETIPWLLFSTILVSSDPMLTAIAIRD
LGLSRSLINLINGESLMTAIMSLIVFTSIEDINVSLKTKVNHSLVFEILLEIWSYFLASF
LLGILCSKLIQLWISTVFGDDVYHISLCVSILHLIFFISELVGMSGIFTLAIMGLFLNST
SFKPGVEALLLEFWNCLSFVASLMVFTFVGLLIPAHMYLYITFSDIYYSLNIYFTLIVLR
LLVFLIMSPVLSRLGHGFSWRWAFIMVWSEMKGTPNINMALLLAYSELSLGSEREKSQVL
FHGVSVCLITLIVNRFILPMAVSKLGLRDVTSTKYKSLYCTFQHFQELTKSAASALKFDK
DLANADWNMVEKAIILQNPYALNQGEQTEHQKVTCLNCKGIDETLNVEATELANRRLLSA
QIASYQRQYRNEILSQSAVQVLVGAAGSFGEKKGEYMGPEAIKNYSESKKLLAFIRKVLL
NWVYNTKKEKGIPSRHCILRLCHKIVFTDEFEYIGYLVTLMNMFPIIISWIPNLSEIYDQ
ELRYSNYSFLAFYIVEALFKMAAMRKEYFLQAWNLFELAITSVGIIDIILIETNSITYTL
DFILTVIFIKIVRFLRLLRILKLITPKLLQIIDQKMSHQLSLKYAILKGYVQGEEDIMTI
IDQISSSKQVKQMLLKRIMKNTGHAMKELGYLEYDHPEIAVTMKTKEEINVMLNLAREIV
KVFRSKGIIHKIEGSEINKLIMAKKREILDFLPIIKPLTIEEALYHIPWLDKDKDHIHFI
QERARVVTFDCGNDIFEEGDEPKGIYVIISGMIKLQRSKPGFGIDQMFWESEEKDYPLMY
TDYVISGEIIGELNCLTNKPMMYSATCKTVVELCFIPIKHLYEAFEQCCPHIEYKMWLKL
GLSIAAKKMREHLSYEDWNYKMQLKLRNVSVKDIPKNTKTDIYDETVTYVILIHGAVEDC
QSRKAYKAPSLIPITCCQVQGTEDFTKVMIVQTLVDLKKFRWNTRKYVPSRKASLPVSSS
KLCKEDLQFDTNIEI
Download sequence
Identical sequences M3XMP3
ENSMPUP00000000343 ENSMPUP00000000343 XP_012916372.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]