SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003805 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003805
Domain Number 1 Region: 545-577,717-791
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000151
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000003805
Domain Number - Region: 234-295
Classification Level Classification E-value
Superfamily Thiolase-like 0.0583
Family Thiolase-related 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003805   Gene: ENSMPUG00000003835   Transcript: ENSMPUT00000003874
Sequence length 965
Comment pep:novel scaffold:MusPutFur1.0:GL897054.1:2701927:2778587:-1 gene:ENSMPUG00000003835 transcript:ENSMPUT00000003874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQPERNPQGFGYKYRENSFTYDVKRDVYNEETFQQEHRRKSISSGNLDIDITTFRHHVQ
CRCSWHKFLRCIITIFPFLEWVCLYRFKDWLLGDLLAGITVGLVQVPQALTFSLLTRQLI
PPLNVCYAAFCSSVVYIILGSCHQMSIGSFFLVSALMIDVLRLYPFNNGNLILGTFIKDD
FSKPSFLADYNRSLSVVASTTFLTGIIQLSMGLLGFGFIATYLPEAAISAYLAATALHII
LSQLTCIFGIMISFHAGPISFFYNIVNYCVTLPKANSTSILLFLTAVVVLRINKCIRISF
NQYPLEFPMEIFLILGFTAFANKISMATETSRTLIDMIPYSFMFPVTPDLKILPELILEA
FSLALVSSSLLIFLGKKIASYHNYYVNSNQDLIAIGLCNVISSFFRSCVFTGAIIRTIIQ
DKTGGRQQFASLVGAGVMLLLMVKVGHFFHEMPNAILAGIILSNILPYLETIYNLPSLWR
QNQYDCVIWLVTFISAIFLGLDVGLLVSVGFAFFIVTVQSHRTKILLLGQIPNTNIYRNF
NDYREVTNIPGVKIFQCCNSITFVNVNDLKHKLLKEVEMVRVPLKEEEVFRLFNRSEEGS
QEEKICHCFCNCDEVEPSPRVVYTERFESKQDQDSSSINLIRCSRFDSMHMSQSMSDEQV
PYVQSSTSYRNPGQNYEDVDQAWLSNNPSRNSSMPLPGIAEKQGRNRSFLPFSDSSLLTS
IHTIILDFSMVHFVDPQASVSLRQMCNAFQNANILVLISGCHSSVVRAFEKNDFFDAGIT
KAQLFLTLHDAVLFALSRKFPESSELSVDESETVIQETYSETDKLGNLRGKTNSSSLYVS
KNINSDYSMFQEPITEEESELDMEMEPPLESEQEPGLDLELDLDREMEAELEPEPEVESE
LELDPESKSKPRPKAHTYPRQQYWPLYQSMPPRSPTQDQPRTQSLERRNLPKNSYSPKGN
KTADP
Download sequence
Identical sequences M3XXK5
ENSMPUP00000003805 ENSMPUP00000003805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]