SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004312 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004312
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-56
Family YWTD domain 0.00000531
Further Details:      
 
Domain Number 2 Region: 180-410
Classification Level Classification E-value
Superfamily YWTD domain 5.49e-51
Family YWTD domain 0.00000234
Further Details:      
 
Domain Number 3 Region: 783-1040
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-37
Family YWTD domain 0.0000727
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-28
Family YWTD domain 0.0000845
Further Details:      
 
Domain Number 5 Region: 1171-1207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1133-1169
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1093-1131
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 739-790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000299
Family EGF-type module 0.021
Further Details:      
 
Domain Number 9 Region: 436-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000573
Family EGF-type module 0.009
Further Details:      
 
Domain Number 10 Region: 135-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1050-1102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004312   Gene: ENSMPUG00000004345   Transcript: ENSMPUT00000004388
Sequence length 1465
Comment pep:novel scaffold:MusPutFur1.0:GL896969.1:5413504:5483707:1 gene:ENSMPUG00000004345 transcript:ENSMPUT00000004388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANL
DGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKRKEILSALYSPMDI
QVLSPERQPYFHTRCAEDNGGCSHLCLLSPREPFYTCACPTGVQLHDNGKTCKAGAEEVL
LLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDG
SGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAI
VLHPVMGLMYWTDWGENPKIERANLDGQERHILVNTSLGWPNGLALDLQEGKLYWGDAKT
DKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQ
LPDLMGLKAVNVAKAVGTNACADGNGGCSHLCFFTPHAAKCGCPIGLELLSDLKTCIVPE
AFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFM
NGSSVEHVIEFGLDYPEGMAVDWVGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPR
SLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLD
TNMIESSDMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQG
HLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLCLAVPGGHRCGCASHYTLDPSSRNCSPP
TTFLLFSQKCAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAK
DDGTQPFVLTSPSPSQNPDRQPHDLSIDVYSRMLFWTCEATNTINVHRLNGDAMGVVLRG
DRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNRLG
KLFWVDADLKRIESCDLSGANRLTLEDANIVQPAGLTVLGRHLYWIDRQQQMIERVEKTT
GDKRTRVQGRVAHLTGIHAVEEISLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHL
VLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFP
CARGQCVDLRLRCDGEADCQDRSDEADCDAICLPNQFRCASGQCVLIKQQCDSFPDCIDG
SDELMCEITKPPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQRVLCQRYAGASGPFPH
EYVSGTPHVPLNFIAPGSSQHGPFTGISCGKSMMSSVSLMGGRGGVPLYDRNHVTGASSS
SSSSTKATLYPPILNPPPSPATDPSLYNVDMFYSSNIPTTARPYRPYIIRGMAPPTTPCS
TDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLF
PPPXXXXXXXXXXXXXXXXXXXXXX
Download sequence
Identical sequences M3XZ11
ENSMPUP00000004312 ENSMPUP00000004312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]