SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004883 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004883
Domain Number 1 Region: 274-419,446-494
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.26e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000105
Further Details:      
 
Domain Number 2 Region: 24-160
Classification Level Classification E-value
Superfamily SH2 domain 1.35e-26
Family SH2 domain 0.000000109
Further Details:      
 
Domain Number 3 Region: 204-268
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.08e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004883   Gene: ENSMPUG00000004923   Transcript: ENSMPUT00000004967
Sequence length 494
Comment pep:novel scaffold:MusPutFur1.0:GL896987.1:3582327:3871645:1 gene:ENSMPUG00000004923 transcript:ENSMPUT00000004967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICAGEVENRPKYYGREF
HGIISREQADELLGGVEGAYILRESQRQPGCYTLALRFGNQTLNYRLFYDGKHFVGEKRF
ESIHDLVTDGLITLYIETKASEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNESRKT
SVTNEEHTTVEKISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIA
QGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIRE
IEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANIYPDINIITGALKLYFRDLP
IPVITYDTYPKFIEAAKISNADERLEAVHDVLMLLPPAHYETLRYLMIHLKNSTTNIQKT
SIPENKNLGDCNFIPLGRVTLNEKDNLMNAENLGIVFGPTLMRSPEDSTLTTLHDMRYQK
LIVQILIENEDVLF
Download sequence
Identical sequences M3Y0N2
ENSMPUP00000004883 ENSMPUP00000004883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]