SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007320 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007320
Domain Number 1 Region: 13-119
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.97e-24
Family DEP domain 0.013
Further Details:      
 
Domain Number 2 Region: 219-392
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.88e-16
Family BCR-homology GTPase activation domain (BH-domain) 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007320   Gene: ENSMPUG00000007378   Transcript: ENSMPUT00000007440
Sequence length 529
Comment pep:novel scaffold:MusPutFur1.0:GL896911.1:2123364:2202072:1 gene:ENSMPUG00000007378 transcript:ENSMPUT00000007440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHRIVGPGPYRATKLWNETVELFRARMPLRKHRCRFKSYERCFTAAEAVDWLHELLRCS
QNFGPEVTRKQTVQLLKKFLKNHVIEDIKGKWGQEDFEDNRHLYRFPPSSPLKPYPKKPT
CQKDVIKFPEWNDPPPSTSQENIPVRPVVMNSEMWFKRHSIAIGEVPACRLVYRRQLTEA
NVEEIWKSMTLAYLQKVLGLDSLEEVLDIKLVNSKFIIHNVYSVSKQGVVILDDKSKELP
HWVLSAMKCLANWPNCSDLKQPMYLGFEKDVFKTIADYYGHLKEPLLTFHLFDAFVSVLG
LLQKEKMAIEAFQVCCLLLPPENRRKLQLLMRMMARICLNKEMPPLCDGFGTRTLMVQTF
SRCILCSKDEVDLDELLAARLVTFLMDNYQEILKVPLALQTSIEDRVAHLRRVQIKYPGA
DMDITLSAPSFCRQISPEEFEYQRAYGSQEPLAALLEEVITDAKLSSKEKKKKLKQFQKS
YPAVYQERFPTPESEALLFPEKPKPKPQLLMWALKNPFQPFQRTRSFRM
Download sequence
Identical sequences M3Y7L3
ENSMPUP00000007320 XP_004744660.1.14098 ENSMPUP00000007320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]