SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009543 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009543
Domain Number 1 Region: 31-141
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 8.89e-36
Family Frataxin-like 0.00000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009543   Gene: ENSMPUG00000009619   Transcript: ENSMPUT00000009699
Sequence length 155
Comment pep:novel scaffold:MusPutFur1.0:GL897043.1:5048982:5061223:-1 gene:ENSMPUG00000009619 transcript:ENSMPUT00000009699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLSLHRLDQMVNVKKQSVCWVTVRAVGTVGDPGSLDETTYERLAEKTLDSLAEFFEDLAD
KPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGRNWVY
AHDGVSLHELLAAELTEAFRTQLDLSSLAYSGKGA
Download sequence
Identical sequences M3YDY6
ENSMPUP00000009543 ENSMPUP00000009543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]