SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011891 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011891
Domain Number 1 Region: 522-554,658-733
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000502
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011891   Gene: ENSMPUG00000011983   Transcript: ENSMPUT00000012086
Sequence length 790
Comment pep:known scaffold:MusPutFur1.0:GL896951.1:8776957:8803689:-1 gene:ENSMPUG00000011983 transcript:ENSMPUT00000012086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPRPRYVVDRAVYSLTVLDDEFEKKDRTYPLGEKLRHAFRCSSAKTKAVVFGLLPVLS
WLPKYKIKDYIIPDLLGGLSGGSIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGI
HQMVPGTFAVISILVGNICLQLAPESKFWVFDNATNKSYVDTAAMEAERLHVSATLACLT
AIIQMGLGFVQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGLTIPSYAGPGSIIFT
FIDICKNLPHTNIASLIFALISGVFLVLVKELNARYMHRIRFPIPTEMIVVVVATAISGG
CKMPQKYHMQIVGEIQHGFPTPVLPVVSQWKDMMGTAFSLAIVGYVINLAMGRTLASKHG
YDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITML
VLGSYLYPLPKSVLGALIAVNLKNSLRQLADPYYLWKKSKLDCCVWMVSFLSSFFLSLPY
GVAVGVAFSALVVVFQTQFRNGYALAQVMDTDIYVNPKTYNRVQEIEGVKIVTYCSPLYF
ANSEIFRQKVIAKTGVDPQKVLLAKQKYLRRQEKGRLRPTQQRKSLFMKTKTVSLQELQQ
DFENASPTDPNNNQTPANGASVSYITFSPDSSPAAHCEPPASAETPSEPSDMLASVPPFV
TFHTIILDMSGVSFVDLMGIKTLGKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGC
LERDHIFPSIHDAVLFAQANAREVVPGRDFQGAPVDPELSLYDLEDSPSYWDLEQEMFGS
MFHTETLTAL
Download sequence
Identical sequences M3YKN4
XP_012913694.1.14098 XP_012913695.1.14098 XP_012913696.1.14098 XP_012913697.1.14098 ENSMPUP00000011891 ENSMPUP00000011891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]