SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014005 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014005
Domain Number 1 Region: 575-605,644-722
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000133
Family Anti-sigma factor antagonist SpoIIaa 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014005   Gene: ENSMPUG00000014113   Transcript: ENSMPUT00000014228
Sequence length 759
Comment pep:novel scaffold:MusPutFur1.0:GL896898.1:28490805:28517473:-1 gene:ENSMPUG00000014113 transcript:ENSMPUT00000014228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLERKEQNDLSPKNSVEENQQNLSLSDMHLELERGSCTALKQFEASDQSTPYHRIHMEP
QEKSTTDFKQFVIKKLHKSCQCSSTRAKNMILGFLPVLQWLPKYDLKKNILGDVMSGLIV
GILLVPQSIAYSLLAGQEPIYGLYTSFFASIIYFLLGTSRHISVGIFGILCLMIGEVVDR
ELLKAGYDTAEGMPSHFGMVSNGSELLNQTLDWMCDRSCYAIAIGSTVTFLAGVYQVAMG
FFQVGFVSVYLSDALLSGFVTGASFTILTSQAKYLLGLSLPRSSGVGSLITTWIQIFRNI
HKTNLCDLITSLLCLLVLLPTKELNEHFKSKLKAPVPTELIVVVAATLASHFGKLNEKYN
TSIAGSIPTGFMPPKAPDWNLIPSLAVDAIAISIIGFAITVSLSEMFAKKHGYTVKANQE
MYAIGFCNIIPSFFHCFTTSAALAKTLVKESTGCQTQLSGVVTALVLLLVLLVIAPLFYS
LQKSVLGVITIVNLRGALLKFKDLPKMWKVSRMDTVIWFVTMLSSALISTEIGLLTGVCF
SMFCVILRTQKPKTSLLGLVEESEIFESMSAYKNLQTKPGIKIFRFVAPLYYINKECFKS
ALYKKTLNPVLVKAARKKAAKKKIMKETVILSGIQDEVSMQLSLDPLDLHTIVIDCSAIQ
FLDTAGIHTLKEVRRDYEAIGIQVLLAQCNSSVRDSLACGEYFKEEEENLLFYSVYEAMA
FAEYQNQKGAFGSHHLDGGNGMMSRDLTLCAKCTSGEER
Download sequence
Identical sequences M3YRP5
ENSMPUP00000014005 ENSMPUP00000014005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]