SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017013 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017013
Domain Number 1 Region: 136-323
Classification Level Classification E-value
Superfamily DNA-glycosylase 1.48e-49
Family DNA repair glycosylase, 2 C-terminal domains 0.0000000478
Further Details:      
 
Domain Number 2 Region: 11-135
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 8.95e-39
Family DNA repair glycosylase, N-terminal domain 0.000000653
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017013   Gene: ENSMPUG00000017122   Transcript: ENSMPUT00000017267
Sequence length 345
Comment pep:known scaffold:MusPutFur1.0:GL896899.1:32715972:32721358:1 gene:ENSMPUG00000017122 transcript:ENSMPUT00000017267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLARSLMLCSMEHRTLASFPALWASIPCPRSELRLDLVLASGQSFRWREQNPAHWTGVLA
NQVWTLTQTEEQLYCTVYRGDKGWVGRPTPEELKTVYQYFQLDVSLAQLYHHWSSVDPHF
QEVAQKFQGVRLLQQDPIECLFSFICSSNNNIARITGMVERLCEAFGPRLIQLDDVTYHG
FPSLQALAEGPEVEVQLRTLGLGYRARYVSTSARAILEEQGGLPWLQQLRKAPYEETHKA
LCTLPGVGTKVADCICLMALDKPQAVPVDVHMWQIAQRDYSWHPTTSQAKGPSPQANKEL
GNFFRSLWGPYAGWAQAVLFSADLRQPHRAREPPAKRRRSTDPEV
Download sequence
Identical sequences M3Z0A2
ENSMPUP00000017013 ENSMPUP00000017013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]