SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018129 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018129
Domain Number 1 Region: 525-556,638-712
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000129
Family Anti-sigma factor antagonist SpoIIaa 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018129   Gene: ENSMPUG00000018243   Transcript: ENSMPUT00000018395
Sequence length 760
Comment pep:novel scaffold:MusPutFur1.0:GL896901.1:16915052:16937676:1 gene:ENSMPUG00000018243 transcript:ENSMPUT00000018395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEPIGNQYVVARPVYSANNLSISEHSEMRAEESSQLKCCKSQANCSTQKAKKIALSLFP
IASWLPTYQIKEWLLSDIVSGISTGLVAVLQGLAFALLVTVPPSYGLYAAFFPVLVYFFL
GTSKHISVGPFPVLSMMVGAVVVKLTPSESTAALEISNSSMSNDSSTDEYKVMVAATVTV
LSGIIQLLMGVLRVGFLVIYLSESLISGFTTAAAVHVLVSQLKFMLQLTVPAHTDPFSIF
KVLNSVFTQIEKTNIADLVTSLIILVIVFVVKEINQRYKAKLPVPIPIELIMTVIATGVS
YGFDFENRFKVAVVGEMKRGFQPPIAPDTQIFQETIGDSFGIAIVGFVVAFSVASVYSLK
YDYPIDGNQELIALGLSNIFSGSFQGFAGSTALSRSGVQESTGGKTQIAGILSAIIVLIV
ILALGFLLEPLQKSVLAALALGNLKGMLMQFTEIRRLWRKDKYDCLIWIMTFIFAIVLGL
GLGLAASVAFQLLTIVFRTQFPKCSTLANVGRSNIYKNKKDYSDMYEPEGVKIFRCPAPI
YFANIHFFKQKLIDAVGFNPLRILRKRNKALKKIRKLQKKGLLQVTPKGFICTNDGFKDS
DDELDNNEIEELDQPIHTSDLPFQIDWNADLPLNMVVPQISLHSLILDFSAVSFLDISSM
RGLKTILQEFIRINVDVYIVGSDDDFIEKLVQCEFFDDEVKDSIFFLTIHDAVLHIWMTK
DYNASKFNASQEKEMKFDFTINTNGGLRNRECQVPVETKF
Download sequence
Identical sequences M3Z3G7
ENSMPUP00000018129 ENSMPUP00000018129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]