SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018153 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018153
Domain Number 1 Region: 491-523,598-672
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000589
Family Anti-sigma factor antagonist SpoIIaa 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018153   Gene: ENSMPUG00000018267   Transcript: ENSMPUT00000018419
Sequence length 704
Comment pep:novel scaffold:MusPutFur1.0:GL896901.1:20999764:21049819:1 gene:ENSMPUG00000018267 transcript:ENSMPUT00000018419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHAEENEILAASQRYYVERPIFSHPVLQERLHKKDKISDSIGDKLKQAFTCTPKKIRNI
IYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGPFAVISLMIGGVAVRLVPDDIV
IPGGVNATNGTEARDALRVKVAMSVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAA
AVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKE
FNERFKEKLPAPIPLEFFAVVMGTGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFH
LVYVDAIAIAIVGFSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSL
SRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFAD
LPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDT
DVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSSALKRKTGVNPAVIMGARRKAMKK
YAKEVGNANVANATVVKVDAEVDGEDATKPEEENDEVKYPPIVIKNTFPEELQRFMPPGE
NIHTVILDFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVINDLTQNRFFENPA
LKELLFHSIHDAVLGSQLREALAEQEASVLPPQEDSEPNATAEA
Download sequence
Identical sequences M3Z3J1
XP_004739638.1.14098 ENSMPUP00000018153 ENSMPUP00000018153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]