SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568179022|ref|YP_008951818.1| from Bacillus amyloliquefaciens LFB112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568179022|ref|YP_008951818.1|
Domain Number 1 Region: 25-304
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.8e-88
Family L-arabinose binding protein-like 0.000000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568179022|ref|YP_008951818.1|
Sequence length 305
Comment D-ribose transporter subunit RbsB [Bacillus amyloliquefaciens LFB112]
Sequence
MKKAIITIAALSLFLLSACSLEPPQWAKPSNTKHKKEFTIGLSVSTLNNPFFVSLKEGVV
KEAKKRGMKVIIVDAQNDSSKQSNDVEDLIQQGVDALLINPTDSSAISTAVESANSLGIP
VIALDRSAEHGKVETLVASDNVKGGEMAADYLADQLGKGAKVAELQGVPGASATRERGTG
FHHIADKKLDVVTKQAADFDRTKGLTVMENLLQGHPDIKAVFAHNDEMALGALEAINSSG
KHILVVGFDGNKDAISSIKSGKLTATVAQQPELIGKLAAEAAEQVLKGEKVKKTISAPLK
LQTQK
Download sequence
Identical sequences WP_024085886.1.101474 WP_024085886.1.24042 WP_024085886.1.46685 gi|568179022|ref|YP_008951818.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]