SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MVEG_07454T0 from Mortierella verticillata NRRL 6337

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MVEG_07454T0
Domain Number 1 Region: 25-145
Classification Level Classification E-value
Superfamily DOPA-like 9.29e-30
Family DOPA dioxygenase-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MVEG_07454T0
Sequence length 172
Comment | MVEG_07454 | Mortierella verticillata NRRL 6337 hypothetical protein (173 aa)
Sequence
MSPTNSIMSLSLSSQSTPDSLKSTIAAEVKEYHFHLYYFENNAKSRASAVVIRNRLGELV
DQGYLKVVPQTIYGGVFPGPTGPHVIGSFEVWCPIEGFARMFSWFTLNRGSHSVLVHPLT
KEQLVDHTDRAIWMGQSLPLDFEIFKQDVLDYYPLEYPEYGLGYSAKGAIVA
Download sequence
Identical sequences MVEG_07454T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]