SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MVEG_02573T0 from Mortierella verticillata NRRL 6337

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MVEG_02573T0
Domain Number 1 Region: 1-720
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.27e-244
Family Motor proteins 0.0000000000469
Further Details:      
 
Domain Number 2 Region: 1018-1103
Classification Level Classification E-value
Superfamily SH3-domain 9.98e-24
Family SH3-domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MVEG_02573T0
Sequence length 1254
Comment | MVEG_02573 | Mortierella verticillata NRRL 6337 myosin I (1255 aa)
Sequence
MTLLTKVQNENINENLKKRFDNQEIYTYIGHVLISVNPFRDLGIYTDEVLKTYQGKNRLE
VPPHVFAIAESAYYTMNAYKENQCIIISGESGAGKTEAAKRIMQYIATVSGGESSQIKEI
KDMVLATNPLLESFGCAKTLKNNNSSRHGKYLEIQFNAQGEPVGAVITNYLLEKNRVVGQ
IENERNFHIFYQYCKAAPANYQEQFGMTGPESFLLTNRSGCLSVDGIDDVHDFSETIQAM
RVIGLSQQEQDEIFRMLATILWLGNVQFSENAEGYAQITDNDVIAFIAYIMEVDSELLIR
TLTSRVVETQRGGRRGSMYESPLNTVQAAAVRDALCKGIYNNLFEWIVSRVNVSLRQRGA
HAYTIGVLDIYGFEIFEENSFEQLCINYVNEKLQQIFIELTLKTEQEEYVREKIKWTPID
FFNNKIVCDLIEEKRPPGIFAAMNDACATAHADSNAADNSLVQRLSGLSSNPHFESRGAS
FLVKHYAGDVMYQISGMTDKNKDLLSKDILTMIASTNNAFLSSLFPEPVDLDNKRRPPTA
GDKIKSSAGVLVQNLMQCTPSYIRTIKPNQNKSPTEFDTKMVLHQVKYLGLCENIRVRRA
GFASRQTYEKFLERFYLLSPKTSYAGEYTWQGDPRSGVERILKDTSVSAEEWQMGTTKIF
IRHPETLFALETLRDRYWHNMAIRIQRAWRNYMKYRNECAIRIQRCWRKNKDQIQWLQLR
DYGHQVLAGRKERRRFSLVSMRRFLGDYLGVNSKGGQGQLIKQAINISDQDYVVFSSRVQ
MLVARAMRSSKPSPRTLVLTATNMYLVVSQLVNNVLSLKLERTVMLNAIKAVSISNLRDD
WMVFSVDTMNPEEGDIVLECTFKTELITHLLQRSGGRIGVNVGPQFEYPKKKGKTGHIKF
VKDDRVKTESYKSHVVTTPSGEAANSPSWPVAERKPVAARPITSGKLIKRGGPSSSNQSQ
GSRRPPAATTPRVVPVVNAAVSNRASVQAPVRSPTVSTGSSSAPVKRQAPPPPPPAPAAE
SPPPAPAKPMYKAIYNFVSEDAGEVSFVKDDVMDILEKDENGWWLAKKDGKEGWVPSNYL
VEVPAPKPTAAPALPAKRQPPPPPAAVAAPKPVSANSSPSAPRHAAVSINGERAAVAATS
NTNALHAGFGGPGNVGGVPGWKVALEAKKAAAAAAAGGAPAPAPPAPSSSPTPAARRPGP
PAVAPKPSVGPKPTIPPRAPVNSSGPKPAVAARPATGGKSLQEILAARRQQNDD
Download sequence
Identical sequences MVEG_02573T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]