SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|538370134|ref|YP_008509146.1| from Streptococcus anginosus C1051

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|538370134|ref|YP_008509146.1|
Domain Number - Region: 19-112
Classification Level Classification E-value
Superfamily Apolipoprotein 0.000196
Family Apolipoprotein 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|538370134|ref|YP_008509146.1|
Sequence length 155
Comment hypothetical protein SAIN_0699 [Streptococcus anginosus C1051]
Sequence
MGKFSSILLGTLSGAAAAVFLTSKKGKEVTAKVSDFMNGVKENPDDFKEQVVQKANHFSN
QAAEAVNQAKEKVESGEITGETILDSVKEVTKQVVDFSQEKMQEWKEKMTPEGISPEDFK
KTEQEPIDKETTSEDIVIDLTENQELENEDKKIED
Download sequence
Identical sequences A0A0P0N804 A0A1F1E923 A0A1S1FGS5
gi|538370134|ref|YP_008509146.1| WP_003025111.1.16627 WP_003025111.1.45477 WP_003025111.1.46706 WP_003025111.1.58305 WP_003025111.1.65477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]