SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2000472510 from Sludge/Australian, Phrap Assembly

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2000472510
Domain Number 1 Region: 393-479
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000147
Family Anti-sigma factor antagonist SpoIIaa 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2000472510
Sequence length 492
Comment Sulfate permease and related transporters (MFS su perfamily) [Sludge/Australian, Phrap Assembly]
Sequence
MMKSLRQDWLSNVRNDLLAGIVVALALIPEAIAFSIIAGVDPKVGLYASFSIAAIIAFAG
GRPGMVSAATGAMALLMVTLVKDHGLQYLLAATVLTGVLQILAGWLKLGALMRFVSRSVI
TGFVNALAILIFMAQLPELTNVTWHVYAMTAAGLGIIYGFPYITKAVPSPLVAIVVLTGV
AIFLGLDIRTVGDMGKLPDSLPVFLLPDVPLNLETLKIIFPVSATLAVVGLLESMMTASI
VDDLTDSNSNKNRECVGQGVANIATGFLGGMAGCAMIGQSVINVKSGGRGRLSTLAAGVF
LLLMVVFIGDWVARIPMAALVAVMIMVSIGTFNWASIRNLREHPKSSSMVMLATVVVTVG
THDLAKGVLIGVLLSGFFFAHKVGQILRVTSRTEDEGRVRTYTITGQVFFASADRFINTF
DYKEVIEKVRIDVSRAHFWDITAVSALDKVVIKFRREATEVEVIGLNEASATMVDKFAVH
DKDGAEDMLMGH
Download sequence
Identical sequences A0A0M2DW77 A0A1Y1J3K0 D0IY16 Q1LEG4
266264.Rmet_4472 266264.Rmet_4600 688245.CtCNB1_2514 gi|264678649|ref|YP_003278556.1| gi|94313397|ref|YP_586606.1| gi|94313522|ref|YP_586731.1| gi|94313397|ref|YP_586606.1|NC_007974 gi|94313522|ref|YP_586731.1|NC_007974 GO.9233 2000472510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]