SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2029901933 from Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2-

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2029901933
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Cgl1923-like 2.09e-42
Family Cgl1923-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2029901933
Sequence length 161
Comment NTS_CREO_AMB_1665720 PAC2 family. [Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2-]
Sequence
HDITGIVVLGAMLADVPHTRPISVFASSESAQLRQEFGLERSSYEGPVGILTVLSDVAEV
VGIPTVSVWGRVPHYVHNAPSPKATLALIEKLEEIIGVPIPRGDLEEEASAWESGIDALA
GDDDDMAAYIEQLEQARDTVDSPRGQREAIAQEFERYLRRR
Download sequence
Identical sequences 2029901933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]