SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2032769680 from Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2032769680
Domain Number 1 Region: 1-47
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 0.000000000127
Family Frataxin-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2032769680
Sequence length 48
Comment FACENCEE_4536770 Protein implicated in iron transport, frataxin homolog [Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+]
Sequence
MVTLTASSREKCIVNTQRAVRQIWVAGKSQGIHFSLDEATGTWKDDKG
Download sequence
Identical sequences 2032769680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]