SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2033351012 from Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2-

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2033351012
Domain Number 1 Region: 1-155
Classification Level Classification E-value
Superfamily Cgl1923-like 1.83e-48
Family Cgl1923-like 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2033351012
Sequence length 160
Comment FACENCTA_5187310 Archaeal enzymes of ATP-grasp superfamily [Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2-]
Sequence
EPSFRWKGFCRQILDLSDALGVQLVVTLGALLADVPHSRPVQVVGLSSDEALTRHVEVEA
ASYEGPTGITGVLHTACAEAGVPSASLWASVPHYVAAAPNPKAALALVRKLEGLVGVSVD
AGELETAAAEYERQVSLAVQADPEVQAFVERLEKAAAEDE
Download sequence
Identical sequences 2033351012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]