SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2033394553 from Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2033394553
Domain Number 1 Region: 12-58
Classification Level Classification E-value
Superfamily Cgl1923-like 0.00000000000235
Family Cgl1923-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2033394553
Sequence length 58
Comment FACEMDA_46930 hypothetical protein [Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient)]
Sequence
VTSSNYSGAKGPDLPELHNTIIVAAFEGWNDAGDAASDALEHLDAIWEAETIIEIDDD
Download sequence
Identical sequences 2033394553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]