SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2033704122 from Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2033704122
Domain Number 1 Region: 73-122
Classification Level Classification E-value
Superfamily Cytochrome c 0.00000000000488
Family Two-domain cytochrome c 0.054
Further Details:      
 
Weak hits

Sequence:  2033704122
Domain Number - Region: 12-34
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 0.0131
Family NAD-binding domain of HMG-CoA reductase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2033704122
Sequence length 125
Comment FACEMDA_5445080 Cytochrome c553 [Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient)]
Sequence
VVKKAWAWIWHPRVTTSMMRIHLTWETEDAMGGNRRRGPAIQAALLASLVFAGIAPGTAR
ADMIDTSGMKPWEVCALCHGLDGISKMAKFPRLAGQRRAYIEKQLHDFRAQRRHNDNGQM
AAVVT
Download sequence
Identical sequences 2033704122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]