SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2001214760 from Soil microbial communities from Minnesota Farm

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2001214760
Domain Number 1 Region: 17-128
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 0.000000000017
Family Substrate-binding domain of HMG-CoA reductase 0.003
Further Details:      
 
Weak hits

Sequence:  2001214760
Domain Number - Region: 114-191
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 0.00068
Family NAD-binding domain of HMG-CoA reductase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2001214760
Sequence length 198
Comment Hydroxymethylglutaryl-CoA reductase [Soil microbial communities from Minnesota Farm]
Sequence
VEQRQAALRTLPHWDPRDDFIWHWPRPVEEFTAAQEALTAHMVLPVGVVGPLRLDLGRYH
IAPENGRLVEVRRETDDVYVPLAHTEGGLSASMLRGMAAAFESGGVQTFVLHDRLTRASC
FVYRSTEEAVIFSRWVRAQVATMREWLRDPQNPLAVQQVGGVPRLSHHALLWEVDTHVVG
AACHVLYRYTTACRANYL
Download sequence
Identical sequences 2001214760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]