SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2001337371 from Soil microbial communities from Minnesota Farm

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  2001337371
Domain Number - Region: 104-161
Classification Level Classification E-value
Superfamily Cgl1923-like 0.0445
Family Cgl1923-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2001337371
Sequence length 185
Comment [Soil microbial communities from Minnesota Farm]
Sequence
MRDDGVRHKPEFFRLPELPAVDRIWVSVVTYFDLHPLVIDHRALHFPEIRKAMWMSGTFD
ELTDEQKARFKSVMEKLEKLDVPELLAESSRLRLPKPMTPELKPRYRSNFAGAIAAQKVL
AYINELNDANERRIELYHEIARIKKEADELESTDPEKAESYRVTMGRLAGMQEVAIHRSR
ASTKG
Download sequence
Identical sequences 2001337371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]