SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2021949838 from Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  2021949838
Domain Number - Region: 43-84
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 0.0471
Family Frataxin-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2021949838
Sequence length 106
Comment SRBS_4107890 hypothetical protein [Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil]
Sequence
KQELEKVDHSVRHQFHRAKRLLSRETSLLDDKHHIRIQTMLEHSQALKVIYEKRLALQQI
WVKTSSNGHDMLAAIKDWVHEAEASGIQSLRDFADQLKTYSLRPAA
Download sequence
Identical sequences 2021949838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]