SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2007986286 from Wastewater Terephthalate-degrading communities from Bioreactor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2007986286
Domain Number 1 Region: 3-112
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 2.09e-43
Family Phosphoglycerate kinase 0.000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2007986286
Sequence length 113
Comment tadcc71500 phosphoglycerate kinase (EC 2.7.2.3) [TA reactor DNA contigs from 4 sample (Terephthalate degrading reactor metagenome contigs from 4 samples)]
Sequence
MSMGPVPEGWRILDVGPETVAAFGKVIAGAGTIVWNGPMGVFEDPRFAQGTFGLAKSVAE
SKAVSIVGGGDSVAAINKSGLADKITHISTGGGASLEMLEGLTLPGVAALLDK
Download sequence
Identical sequences 2007986286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]