SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|402571825|ref|YP_006621168.1| from Desulfosporosinus meridiei DSM 13257

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|402571825|ref|YP_006621168.1|
Domain Number 1 Region: 87-154
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 1.31e-26
Family CO dehydrogenase ISP C-domain like 0.00043
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.31e-23
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|402571825|ref|YP_006621168.1|
Sequence length 168
Comment aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS-like protein [Desulfosporosinus meridiei DSM 13257]
Sequence
MYKRIAFTVNGKAYNFEVDVRESLLDVLRSHLGFTGAKQGCGVGECGACSVLIDGVPTDT
CIYLAVWADGKEIRTIEGVAEKNGELSEVQKAFVDEGAVQCGFCTPGLVLTTTALKESGK
DYTREELKRELSGHLCRCTGYQNILKAAEKSLEGHVCTCVDSPHYKGE
Download sequence
Identical sequences A0A099SHW4 J7IND3
WP_014902216.1.33588 WP_014902216.1.68571 gi|402571825|ref|YP_006621168.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]