SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|409910992|ref|YP_006889457.1| from Geobacter sulfurreducens KN400

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|409910992|ref|YP_006889457.1|
Domain Number 1 Region: 5-316
Classification Level Classification E-value
Superfamily FMN-binding split barrel 2.63e-102
Family UbiD middle domain-like 0.000000599
Further Details:      
 
Domain Number 2 Region: 317-471
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 1.28e-32
Family UbiD C-terminal domain-like 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|409910992|ref|YP_006889457.1|
Sequence length 471
Comment UbiD family decarboxylase [Geobacter sulfurreducens KN400]
Sequence
MANGDLHDFLAELERLGDLHRVAAEVDPVLEVAAITDRVSKLPGGGKGLLFERVKGSRFP
LVTNVFGSAGRVAAALGAATLDDLTARMESLLAAVPPAKTASPLEAMASLAEMRRFAPMI
VEKAPCQEVVEAPDLLRYPFPHSWPGDGGRFITLPLVVTRDPETNTPNCGMYRVRVVDGA
SAGIRWYAGKGGELHCRRHRERGERMPVAVAIGGDPAAILAAILPLPEGFDEMLFAGFLR
GRPLELARCRTSDLLVPAGAELVLEGYVEPGETVMDGAFGNHTGFYAPAASVPLMRLTCI
TRRADCLCPATVVGRPPMEDCYLAKAAERLLLPVLRMRWPEIVDINYPLEWIFNGGAVLS
LRECSSSRVRRIVTELWSSGLAGPGRLLVAVDEGTRVDDPADVAWRAMNAVDWRTDLIIA
ERDAAAAWPGLGSRLAIDATRSAARRYGAEELVPDRETARRVDSRWREYGF
Download sequence
Identical sequences A0A0D5N7R0 Q74G15
gi|39995545|ref|NP_951496.1| NP_951496.1.89865 WP_010941106.1.53615 WP_010941106.1.88929 243231.GSU0437 gi|409910992|ref|YP_006889457.1| GsR91

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]