SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|409912420|ref|YP_006890885.1| from Geobacter sulfurreducens KN400

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|409912420|ref|YP_006890885.1|
Domain Number 1 Region: 2-321
Classification Level Classification E-value
Superfamily SIS domain 1.2e-68
Family mono-SIS domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|409912420|ref|YP_006890885.1|
Sequence length 321
Comment arabinose-5-phosphate isomerase [Geobacter sulfurreducens KN400]
Sequence
MILEEARKVIRIEAEALTRLADTIDGEFEKAVRLILGTRGRVVVTGMGKSGLIGQKIAST
MASTGTPALFLHPAEGVHGDLGMIMKGDVVIAISNSGETEEVVRILPIIKRLGATLVSMS
GNPSSTLAKAGDVFLDISVTEEACPLGLAPTASTTATLAMGDALAVALLIERGFRPEDFA
LFHPGGSLGKKLLLTVGDLMHSGDAVPLVGSATPIRDALFVITAKGLGITGVCAEDGALV
GVVTDGDLRRSLGKGVDILNQPAGEIMTRNPKRINRSELAAKALQVMESHSITSLFVFDD
TADNRPVGVIHLHDLLRAGLA
Download sequence
Identical sequences A0A0D5N1Y9 Q74BY5
gi|409912420|ref|YP_006890885.1| gi|39996991|ref|NP_952942.1| NP_952942.1.89865 WP_010942538.1.53615 WP_010942538.1.88929 243231.GSU1893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]