SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|409912609|ref|YP_006891074.1| from Geobacter sulfurreducens KN400

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|409912609|ref|YP_006891074.1|
Domain Number 1 Region: 5-188
Classification Level Classification E-value
Superfamily SIS domain 3.03e-54
Family mono-SIS domain 0.00000494
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|409912609|ref|YP_006891074.1|
Sequence length 189
Comment D-sedoheptulose-7-phosphate isomerase [Geobacter sulfurreducens KN400]
Sequence
MIDDITAQLRAGRQVLEALERELAGRIASVAELLADSLAGGRKLLVMGNGGSAADAQHFA
AEIVGRFKLERRGLPAVALTTDTSILTAIGNDYGFDAIFRRQVEALADEGDVVVGISTSG
NSRNVQEALLLARERGCRTIGLLGRDGGSIRDIVDLDLTVPSADTPRIQEGHITIIHIVC
DLVEKRLFP
Download sequence
Identical sequences A0A0D5N445
WP_014551745.1.53615 WP_014551745.1.88929 gi|409912609|ref|YP_006891074.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]