SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|409912753|ref|YP_006891218.1| from Geobacter sulfurreducens KN400

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|409912753|ref|YP_006891218.1|
Domain Number 1 Region: 444-551
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000628
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|409912753|ref|YP_006891218.1|
Sequence length 590
Comment proton/sulfate symporter family protein [Geobacter sulfurreducens KN400]
Sequence
MRLTPSSLLPEWLRSYRPADLLPDLAAGAVVAVILAPQGMAYALLAGLPPIMGLYAATVP
LLAYALAGSSRHLSVGPVAIVSLLVHVACSKVAHAGSASYVSAALQLALLTGVLQLLLGT
VRAGFMVNFLSRAAIGGFTSAAALLISLSQFKNLLGISGDGGESALELAAGVVRNIGTLH
LLTSVMGLAAICMLLLLQRFAPRFPAPLAAIVLGIPLTALLHLDQAGVRTVGDLPHGLPP
LSLPPFAADQILTLLPAAVTIALIGYLESFAVAGLIADREKYPIYPNRELVGLGIANVAA
AFFSGYPVTGGFSRTAVNHRAGARTGLAGMITATLIGIILLHFTHLFHYLPKTILAAIVI
VAVAGLVEAAEARYLFRVKPSDGYTFVLTFLVTLGFGVEAGIVAGVIFSLLVFIWRSAHP
HIAELGWLEEEGVFRNIRRYPHAVVPRGMLLVRVDASLYFANMAFVGDWLRATLAERADV
RQIIFDLSGVNDMDAVALAALEVIIEGHGERGIVVAFAGMKGPVRDLAQRAGWQERYGNL
ISFLSLNQAVRQMSTEDMILAGLHSKERESETCSVPATRPTGSTNHGDPA
Download sequence
Identical sequences K1YBP2 Q74AP0
gi|39997410|ref|NP_953361.1| 243231.GSU2312 gi|409912753|ref|YP_006891218.1| NP_953361.1.89865 WP_010942949.1.53615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]