SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378706561|ref|YP_005271455.1| from Shewanella baltica OS678

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378706561|ref|YP_005271455.1|
Domain Number 1 Region: 6-287
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.04e-104
Family G proteins 0.0000000427
Further Details:      
 
Domain Number 2 Region: 484-604
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.11e-47
Family Translational machinery components 0.00000572
Further Details:      
 
Domain Number 3 Region: 271-409
Classification Level Classification E-value
Superfamily Translation proteins 3.03e-33
Family Elongation factors 0.0000596
Further Details:      
 
Domain Number 4 Region: 608-695
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 8.15e-29
Family EF-G/eEF-2 domains III and V 0.00012
Further Details:      
 
Domain Number 5 Region: 407-485
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.55e-25
Family EF-G/eEF-2 domains III and V 0.0000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378706561|ref|YP_005271455.1|
Sequence length 698
Comment translation elongation factor G [Shewanella baltica OS678]
Sequence
MARTTPIERYRNIGICAHVDAGKTTTTERVLFYTGLSHKIGEVHDGAATTDWMVQEQERG
ITITSAAVTTFWRGMDAQFTEHRINIIDTPGHVDFTIEVERSLRVLDGAVVVFCGSSGVE
PQSETVWRQADKYRVPRLVFINKMDRAGADFERVVKQIRTRLGATCVPIQLNIGAEENFK
GVIDLIKMKAINWNESDQGMTFTYEEIPAELAAKAAEMHEYLVEVAAESSDELMDKYLEE
GTLSEDEIKKALRQRTINNEIVLATCGSAFKNKGVQAVLDAVIEFLPAPIDVPPIKGIDE
NDQEVERPSDDNAPFAALAFKIATDPFVGTLTFIRVYSGVLESGSGVYNSVKQKRERVGR
MVQMHANDRTELKEVRAGDIAAAIGLKEVTTGDTLCDNDHRVILERMEFPEPVITIAVEP
KSKADQDKMGIALQKLAAEDPSFRVETDEESSQTLISGMGELHLDIIVDRMRREFGVECN
VGKPQVAYRETIRASVEAEGKFVRQSGGRGQFGHVWLKLEPNEEGAGYEFVNAVVGGVIP
REFIPAVDKGIQEQMKNGVLAGFPVLDVKVTLFDGSYHDVDSNEMAFKIAGSMGFKKGAL
EANPALLEPCMKVEVTTPENYMGDVVGDLNRRRGLIEGMDDGFGGIKIVHAVVPLSEMFG
YATDLRSATQGRASYSMEFLKYSDAPQNIAKAIIESRS
Download sequence
Identical sequences A3DB99 A9KW99 B8EBK8 G0AS79
gi|217975204|ref|YP_002359955.1| gi|386343110|ref|YP_006039476.1| gi|160873323|ref|YP_001552639.1| gi|386322721|ref|YP_006018838.1| 325240.Sbal_4467 399599.Sbal195_0197 402882.Shew185_0193 407976.Sbal223_4059 gi|378706561|ref|YP_005271455.1| WP_006083603.1.19221 WP_006083603.1.35668 WP_006083603.1.35710 WP_006083603.1.60405 WP_006083603.1.74325 WP_006083603.1.76213 WP_006083603.1.8014 WP_006083603.1.85636 WP_006083603.1.86146 WP_006083603.1.93117 gi|126090324|ref|YP_001041767.1|NC_009037 gi|126090324|ref|YP_001041767.1| gi|152998746|ref|YP_001364427.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]