SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378706677|ref|YP_005271571.1| from Shewanella baltica OS678

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378706677|ref|YP_005271571.1|
Domain Number 1 Region: 34-250
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.95e-57
Family G proteins 0.00017
Further Details:      
 
Domain Number 2 Region: 182-330
Classification Level Classification E-value
Superfamily Translation proteins 7.73e-33
Family Elongation factors 0.0059
Further Details:      
 
Domain Number 3 Region: 429-543
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.12e-26
Family EF-G/eEF-2 domains III and V 0.01
Further Details:      
 
Domain Number 4 Region: 333-418
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.00000000000000263
Family EF-G/eEF-2 domains III and V 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378706677|ref|YP_005271571.1|
Sequence length 634
Comment GTP-binding protein TypA [Shewanella baltica OS678]
Sequence
MARFLLWRIELDRHNELLKYPYFCLMVRGLSVLENLRNIAIIAHVDHGKTTLVDKLLSQS
GTLATRGEATERVMDSNDLEKERGITILAKNTAIKWNDYRINIVDTPGHADFGGEVERVL
SMVDSVLLLVDAVDGPMPQTRFVTKKAFAQGLKPIVVINKIDRPGARPDWVIDQVFDLFD
NLGATDEQLDFPIVYASALNGFATLDPDVASDDMTPLFQTIVEKVSFPDADAEGSFQMQI
SQIDYNSYVGVIGIGRIKRGSVKTNQQVTIIGADGKTRNGKMGQVLGYMGLDRTEVEIAN
AGDIVAITGLGELKISDTICAVGAVEAMPALTVDEPTLTMTFQVNTSPFAGKEGKYVTSR
NILERLQTELVHNVALRVEETESPDRFRVSGRGELHLSILIENMRREGYELAVSRPEVIL
KTIDGELCEPYETLTVDVEEEDQGTVIEKLGTRKAEMKDMQLDGKGRVRIDFIIPSRGLI
GFQTEFLTATSGTGLIYHSFDHYGPHKGGDIGQRANGVLISNATGKALTFALFGLQDRGR
LFIGHAAEVYEGQVVGIHARSNDLTVNCLKGKQLTNMRASGTDEAQVLTTPITMTLEQAL
EFIDDDELVEVTPKNIRVRKRHLTENDRKRFNRA
Download sequence
Identical sequences G0ASX6
gi|378706677|ref|YP_005271571.1| gi|386339335|ref|YP_006035701.1| gi|386326353|ref|YP_006022470.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]