SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378707031|ref|YP_005271925.1| from Shewanella baltica OS678

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378707031|ref|YP_005271925.1|
Domain Number 1 Region: 184-376
Classification Level Classification E-value
Superfamily GroEL apical domain-like 2.39e-82
Family GroEL-like chaperone, apical domain 0.0000000997
Further Details:      
 
Domain Number 2 Region: 3-230
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 7.46e-66
Family GroEL chaperone, ATPase domain 0.00000588
Further Details:      
 
Domain Number 3 Region: 372-525
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 1.11e-32
Family GroEL chaperone, ATPase domain 0.0000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378707031|ref|YP_005271925.1|
Sequence length 545
Comment chaperonin GroEL [Shewanella baltica OS678]
Sequence
MAAKEVVFGNDARVRMLAGVNILANAVKVTLGPKGRNVVLDKSFGSPLITKDGVSVAKEI
ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVVEGLKAVAAGMNPMDLKRGI
DKAVIAAVAELKALSQPCADSKAIAQVATISANSDESIGEIIATAMEKVGKEGVITVEEG
QALENELDVVEGMQFDRGYLSPYFINKPETGSVELDHPFVLLVDKKISNIRELLPILEGL
AKTGKPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDVAILTGGTV
IAEEIGLELEKATLEDLGTAKRVVITKDNTTIIDGNGEQTQIAARVSQIKQQVEESTSDY
DKEKLQERMAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV
RVASKIAEVEVLNEDQKHGVVIALRAMEAPLRQIATNAGEEASVVANTVKNGSGNFGYNA
GNDTYGDMLEMGILDPTKVTRCALQFAASIAGLMITTEAMVAEIPQNSAPDMGGMGGMGG
MGGMM
Download sequence
Identical sequences A9L0C1
gi|378707031|ref|YP_005271925.1| gi|160873794|ref|YP_001553110.1| 399599.Sbal195_0672 WP_012196636.1.60405 WP_012196636.1.93117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]