SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378707216|ref|YP_005272110.1| from Shewanella baltica OS678

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378707216|ref|YP_005272110.1|
Domain Number 1 Region: 3-277
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.48e-97
Family G proteins 0.0000000527
Further Details:      
 
Domain Number 2 Region: 475-595
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.29e-39
Family Translational machinery components 0.0000632
Further Details:      
 
Domain Number 3 Region: 261-398
Classification Level Classification E-value
Superfamily Translation proteins 2.01e-32
Family Elongation factors 0.00033
Further Details:      
 
Domain Number 4 Region: 599-692
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 4.32e-27
Family EF-G/eEF-2 domains III and V 0.00042
Further Details:      
 
Domain Number 5 Region: 400-477
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 5.76e-21
Family EF-G/eEF-2 domains III and V 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378707216|ref|YP_005272110.1|
Sequence length 697
Comment translation elongation factor G [Shewanella baltica OS678]
Sequence
MTELSKYRNIGIFAHVDAGKTTTTERILKLTGKIHKIGEVHDGESTTDFMVQEAERGITI
QSAAVSCFWKDHRFNVIDTPGHVDFTVEVYRSLKVLDGGIGVFCGSGGVEPQSETNWRYA
NESEVARIIFVNKLDRMGADFLRVVKQTKDVLAATPLVMVLPIGVEDEFTGVVDLLTRKA
YVWDDSGLPENFEVLDVPADMVDMVEEYREMLIETAVEQDDAVMEAYMEGEEPSMEDIKR
CIRTGTRKLAFFPTYCGSAFKNKGMQLVLDAVVDYLPAPDEVDPQPLTDEEGNETGEFAI
VSADEPLKALAFKIMDDRFGALTFVRIYSGRLKKGDTILNSATGKTERIGRMCEMYADDR
IEIESAQAGDIIAIVGMKNVQTGHTLCDVKHPVTLEAMVFPEPVISIAVAPKDKGGSEKM
GIAIGKMIAEDPSFRVETDEDSGETILKGMGELHLDIKVDILKRTYGVELIVGEPQVAYR
ETITQMVEDQYTHKKQSGGSGQFGKIEYIIRPGEPNTGFVFKSSVVGGSVPKEFWPAVEK
GFASMMNTGTIAGFPVLDVEFELTDGAFHAVDSSAIAFEIAAKGAFRQSIAKAKPQLLEP
IMKVDVFSPDDNVGDVIGDLNRRRGMIKDQVAGVTGVRVKADVPLSEMFGYIGTLRTMTS
GRGQFSMEFSHYSQCPASVAEKVVAQVKERKAAEAKK
Download sequence
Identical sequences A9L1W6
399599.Sbal195_0855 gi|160873976|ref|YP_001553292.1| gi|378707216|ref|YP_005272110.1| WP_006086012.1.60405 WP_006086012.1.76213 WP_006086012.1.93117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]