SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378707641|ref|YP_005272535.1| from Shewanella baltica OS678

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378707641|ref|YP_005272535.1|
Domain Number 1 Region: 2-205
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.32e-57
Family G proteins 0.00022
Further Details:      
 
Domain Number 2 Region: 165-288
Classification Level Classification E-value
Superfamily Translation proteins 3.74e-30
Family Elongation factors 0.0048
Further Details:      
 
Domain Number 3 Region: 400-493
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.63e-25
Family EF-G/eEF-2 domains III and V 0.011
Further Details:      
 
Domain Number 4 Region: 292-370
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.47e-18
Family EF-G/eEF-2 domains III and V 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378707641|ref|YP_005272535.1|
Sequence length 596
Comment GTP-binding protein LepA [Shewanella baltica OS678]
Sequence
MKQIRNFSIIAHIDHGKSTLSDRLIQVCGGLTDREMDAQVLDSMDLERERGITIKAQSVT
LDYKAKDGLVYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAL
DMNLDVVPILNKIDLPQADPERVAAEIEDIVGIDAIDAVRCSAKTGVGVDEVLEVIVAKI
PPPEGDPNAPLQALIIDSWFDNYLGVVSLVRIKHGSLKKGDKFKVMSTGQNHTADRVGIF
TPKQTDKTELKTGEVGFVIAGLKEIHGAPVGDTLTLAKNGAEKPLPGFKKVKPQVYAGVF
PISTDEYENFRDALNKLSLNDASLFFEPESSSALGFGFRIGYLGLLHMEIVQERLEREYN
LELITTAPTVVYEVVMTSGETIYVDNPSDLPAINNIEEMREPIVEANILVPKEYLGNVIT
LCIEKRGTQVNMVYHGNQVAVTYHLPMAEVVMDFFDRLKSTSRGYASLEYNFIRFDPADM
VRLDILINGDRVDALAMVIHRSNIRHRGLALVDKMKELIPRQMFDIAIQAAVGSQIIARS
TVKALRKDVTAKCYGGDVSRKKKLLNKQKEGKKRMKQVGNVEVPQEAFLAVLKLNE
Download sequence
Identical sequences A9L5N4 B8EBQ4
gi|378707641|ref|YP_005272535.1| gi|160874395|ref|YP_001553711.1| gi|217974271|ref|YP_002359022.1| WP_006085065.1.60405 WP_006085065.1.74325 WP_006085065.1.76213 WP_006085065.1.93117 399599.Sbal195_1276 407976.Sbal223_3114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]