SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378707971|ref|YP_005272865.1| from Shewanella baltica OS678

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378707971|ref|YP_005272865.1|
Domain Number 1 Region: 58-530
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.66e-107
Family Pyridoxal-dependent decarboxylase 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378707971|ref|YP_005272865.1|
Sequence length 549
Comment pyridoxal-dependent decarboxylase [Shewanella baltica OS678]
Sequence
MTQKLPRQATASEESLLRIFTAPEDAGSTLSIIEQKLSEDLAGFLGDSIAALEKPLSEIE
TDFQAFEIPTQPRFVSDYTDEIMQNLVAHSVHTAAPSFIGHMTSALPYFVLPLSKMMVGL
NQNLVKIETSKAFTPLERQVLGMMHHLIYDQDTDFYQSWMHSANHSLGAFCSGGTVANIT
ALWIARNQLLKADGEFKGVSREGLLKALRHYGYDDLAILVSERGHYSLGKAVDLLGIGRD
NIISIPTGIDNKVDVAKMRQAALELASKNIKVLAIVGVAGTTETGNVDPLTELAALAKEL
NCHFHVDAAWGGASLLSNKYRHLLTGIELADSVTIDAHKQMYVPMGAGMVLFKDPEFAHA
IAHHAEYILRRGSKDLGSQTLEGSRPGMAMLVHACLQIIGRDGYEILINNSLEKARYFAE
QIKAHKDFELVTEPELCLLTYRYVPACVQAAIQLACEQADTIRVARFNELLDGLTQFIQK
HQREQGKSFVSRTRIQPARYFRQATVVFRVVLANPLTSHDILNQVLVEQSEIAALDNEFL
PVLMAMVAD
Download sequence
Identical sequences A9KWF3
WP_006085345.1.60405 WP_006085345.1.76213 WP_006085345.1.93117 399599.Sbal195_1603 gi|378707971|ref|YP_005272865.1| gi|160874720|ref|YP_001554036.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]