SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART02G12180.2 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART02G12180.2
Domain Number 1 Region: 99-323
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.55e-46
Family C-terminal domain of adrenodoxin reductase-like 0.00001
Further Details:      
 
Domain Number 2 Region: 38-155,321-376
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000122
Family C-terminal domain of adrenodoxin reductase-like 0.0019
Further Details:      
 
Domain Number 3 Region: 326-459
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00000247
Family N-terminal domain of adrenodoxin reductase-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OBART02G12180.2
Sequence length 461
Comment pep:novel chromosome:ABRL00000000:2:9411962:9417618:1 gene:OBART02G12180 transcript:OBART02G12180.2 description:""
Sequence
MGRVRPLHHAARRLLLLFPRPRAFSSAAAAAPSREPLHVCVVGSGPAGFYTADKMLKGHE
GAQVDIIDRLPTPFGLVRSGVAPDHPETKVVLAYGAESDRSLGIPGEDLRGIHSAREFVW
WYNGHPDMCNLAPDLQSTDSAVVLGQGNVALDVARILLRCTSELAATDIADYALDALRGS
TIKKVYLVGRRGPVQAACTAKELREILGLKNVHVFIKEADLVTLPADEEEIRNSRIKRRV
YELLSKAAIAHKGKNNNGQKELHFVFFRRPTRFLPSEDGVTVGAVQLEKTCLKDDGVAGK
QVAVGTGEFEDLKCGLVLKSIGYKSLPVEGLPFDKYRGIVPNLKGRVLSSESENATVEPG
LYVVGWLKRGPTGIVATNLHCAEETVASILEDDKKGLFMGPSDSKKQGRRGLLEILEQKN
IRFVPFDGWEKIDSKEKMAGELKNKPREKITTWNEILMASN
Download sequence
Identical sequences A0A0D3F3L3 A0A0E0H9M7
ONIVA05G03750.3 OBART02G12180.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]