SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OBART12G19840.4 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OBART12G19840.4
Domain Number - Region: 107-172
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0156
Family Tandem AAA-ATPase domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART12G19840.4
Sequence length 185
Comment pep:novel chromosome:ABRL00000000:12:20208121:20213906:1 gene:OBART12G19840 transcript:OBART12G19840.4 description:""
Sequence
MAMAPHSLTHLAVGQVRQLPKGIWAISRIFGSFFITALYRSRNPLFILVYMIESELGSYC
NIACTQSRRIVWKNASSTVNNHENRRTLFYPQWIGGGVDTGKHKDNHYNLQKVPEMLRMP
LTELCLQMKLLHLGGIKSFLPKVVAFEGHEELSHLGYHLANLPVDILIGKVQLKYNLLAH
SSNMT
Download sequence
Identical sequences A0A0D3HX39
OBART12G19840.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]