SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART01G32300.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART01G32300.1
Domain Number 1 Region: 320-423
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.13e-18
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 77-128,157-238
Classification Level Classification E-value
Superfamily POZ domain 0.000000000118
Family BTB/POZ domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OBART01G32300.1
Sequence length 624
Comment pep:novel chromosome:ABRL00000000:1:27175097:27179483:1 gene:OBART01G32300 transcript:OBART01G32300.1 description:""
Sequence
MPARSAVVVVAMEPSSSITIASSSSYLSNGSSPCSVSLAPPGAGAVAAQAAPVAAGEGGG
GGGGGGGGGSSSVEVVSLNRLSANLERLLLDSDLDCSDADVDVADGGPPVPVHRCILAAR
STFFYNLFAARGRGGDGAAGGGGGGGGGGERTGGRPRYKMEELVPGGRVGRDAFLSLLGY
LYTGKLRPAPDDVVSCADPMCPHDSCPPAIRFNVEQMYAAWAFKITELISLFQRRLLNFV
DKTLVEDVLPILQVAFHSELTPVLEKCIRRIARSNLDNVSLDKELPPEVAVQIKEIRQKS
QPNEGDTVISDPVHEKRVRRIHRALDSDDVELVKLLLNESEITLDDANALHYAAAYCDSK
VVSELLDLRLANLNLKNSRGYTALHLAAMRREPAIIMCLLNKGAAVSQLTADGQSAMSIC
RRLTRLKDYNTKMEQGQESNKDRLCIDILDREMIRKPMAVEDSVTSPLLADDLHMKLLYL
ENREAKVAMQIAQADTTPEFGIVPAASTSGKLKEVDLNETPVTQNKRLRSRVDALMKTVE
LGRRYFPNCSQVLDKFLEDDLPDSPDALDLQNGTSDEQNVKRMRFCELKEDVRKAFSKDR
ADNSMFSILSSSSSSSPPPKVAKK
Download sequence
Identical sequences A0A0D3EUG3
OBART01G32300.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]