SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART01G40980.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART01G40980.1
Domain Number 1 Region: 106-204
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.82e-22
Family B3 DNA binding domain 0.0022
Further Details:      
 
Domain Number 2 Region: 595-685
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000746
Family B3 DNA binding domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OBART01G40980.1
Sequence length 691
Comment pep:novel chromosome:ABRL00000000:1:33431807:33435666:-1 gene:OBART01G40980 transcript:OBART01G40980.1 description:""
Sequence
MEAKEEHPGYHFPMRQVEKDGQVVRHQLASMVELIKVPKIEQEEGNADSHGKEKADVVHE
EKTEKVKRRRKRVSDPQRKKACVDCTKRCIRIHGMASSSSEKARPTPTLPSFFKIMVGYF
SENMDIPLPFARTITDMTGSNVYLEDAYGLRWRVRLYLHDDVLSFGHGWKNFVLDHDISV
GEFLVFRQIARSVFTVQIFAISACERIHLCERNKRQSRKRKPGRKTGYPANNQMVKVSSK
DVVKRRKKPRTDEQRYDLDPRQHDMPVRVCIDSGSELRCSESSVKELDAAPDKSHAVVQV
PATECNADPSYNAAGMKTIKNLEAIGASSSTKDVTWDANKSEDYPSFSYPESSNVMTADK
ESERSHQDRPMQLYCELGLEDGNAETENCENSNVLENAELRTPLAMMDLNEVGIDDIFLS
ADIYEFDSDFCSPEAFSVDVNTEGLVANGRTPGDCFGMPETSRCLENKQMTDVPRTSTDD
GSIAVHGIDINALPSNTYPDIDAAPDDCKKDKDVLHSECNKVAQKVSVPAHSSVKQDITK
DGPRQIAAEIMSSGPKTCELTYVRKNSVQPGNNSKGQESGGTKSCVVLAVAANSKKFCIT
IPPPDQTWLELPRRLPVLPRTKKQARKILILKDPSMRLWPVLYQCTPKFNGFIAGWADIS
RENNLREGDTCEFELCSNSELSFQVLVPNLQ
Download sequence
Identical sequences A0A0D3EXK3
OBART01G40980.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]