SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART02G03410.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART02G03410.1
Domain Number 1 Region: 155-295
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.44e-41
Family B3 DNA binding domain 0.0044
Further Details:      
 
Domain Number 2 Region: 1044-1105
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000392
Family PB1 domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OBART02G03410.1
Sequence length 1159
Comment pep:novel chromosome:ABRL00000000:2:2129872:2136488:-1 gene:OBART02G03410 transcript:OBART02G03410.1 description:""
Sequence
MASMKQQQTPASSAVTAAAAASSSATAAVAACEGERKAAAINSELWHACAGPLVSLPPVG
SLVVYFPQGHSEQVIIISLSLSLSSSSIIDLVAASMQKDVDAHVPSYPNLPSKLICLLHG
VNLHADPDTDEVYAQMTLQPVNTYGKEALQLSELALKQARPQMEFFCKTLTASDTSTHGG
FSVPRRAAEKIFPPLDFSMQPPAQELQARDIHDNVWTFRHIYRGQPKRHLLTTGWSLFVS
GKRLFAGDSVIVVRDEKHQLLLGIRRANRQPTNISSSVLSSDSMHIGVLAAAAHAAANSS
PFTIFYNPRASPTEFVIPFAKYQKALYSNQISLGMRFRMMFETEELGTRRYMGTITGISD
LDPVRWKNSQWRNLQVGWDESAAGERRNRVSIWEIEPVAAPFFLCPQPFFGVKRPRQLDD
ESDMENLFKRAMPWLGEEVCIKDTQNQNSTAPGLSLVQWMNMNRQQSSSLANTAAQSEYL
QALGNPAMQNLAADELARQLYVQNNLLQQNCIQFNSPKLPQQMQTMNDLSKAAIPLNQLG
AIINPQDQKQDAVNHQRQQNSIQVIPLSQAQSNLVQAQVIVQNQMQQQKPSPTQNPQRIN
GQRLLLSHQQQDQNLQLQQQLLLQQKQQLQQQQQQQQNQQQLNKSLGQLVNLASQQSKLF
DEELQLQILQKLQQQSLMSQSTSTLSQPPLIQEQQKLITDMQKQLSNSHSLAQQQMMPQQ
EIKPSLQATPLLPTVQQEQQQKLLQKQVSLADVSGVAFQPISSTNVIPKTGGAMIISGAT
QSVVTEEMPSCSTSPSTANGNHFTQSTKNRHCINTERLPPSTAPMLIPTSIDAVTATPLM
TKELPKPNNNVKQSVVNSKLPNVAPGPQNCINNALQTDNLETSSSATSLCPSRTDGLVHQ
GFPSSNFNQHQMFKDALPDVEMEGVDPSNSGLFGINNDNLLGFPIETEDLLINALDSVKY
QNHISTDVENNYPMQKDALQEISTSMVSQSFGQSDMAFNSIDSAINDGAFLNKNSWPAAP
PLQRMRTFTKVYKRGAVGRSIDIGRYSGYEELKHALARMFGIEGQLEDRQRIGWKLVYKD
HEDDILLLGDDPWEEFVNCVRCIRILSPQEVQQMSLDGDLGSNVLPNQACSSSDGVNGWR
PRCDQNPRNPSIGPYDQFE
Download sequence
Identical sequences A0A0D3F0J7
OBART02G03410.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]