SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART02G20600.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART02G20600.1
Domain Number 1 Region: 117-257
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.58e-44
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 550-627
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000491
Family PB1 domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OBART02G20600.1
Sequence length 678
Comment pep:novel chromosome:ABRL00000000:2:18756473:18762505:1 gene:OBART02G20600 transcript:OBART02G20600.1 description:""
Sequence
MAGSVVAAAAAGGGGTGSSCDALYRELWHACAGPLVTVPRQGELVYYFPQGHMEQLEAST
DQQLDQHLPLFNLPSKILCKVVNVELRAETDSDEVYAQIMLQPEADQNELTSPKPEPHEP
EKCNVHSFCKTLTASDTSTHGGFSVLRRHAEECLPPLDMTQNPPWQELVARDLHGNEWHF
RHIFRGQPRRHLLTTGWSVFVSSKRLVAGDAFIFLRGENGELRVGVRRLMRQLNNMPSSV
ISSHSMHLGVLATASHAISTGTLFSVFYKPRTSQSEFVVSANKYLEAKNSKISVGMRFKM
RFEGDEAPERRFSGTIIGVGSMSTSPWANSDWRSLKVQWDEPSVVPRPDRVSPWELEPLA
VSSSQPSPQPPARNKRARPPASNSIAPELPPVFGLWKSSAESTQGFSFSGLQRTQELYPS
SPNPIFSTSLNVGFSTKNEPSALSNKHFYWPMRETRADSYSASISKVPSEKKQEPSSAGC
RLFGIEISSAVEATSPLAAVSGVGQDQPAASVDAESDQLSQPSHANKSDAPAASSEPSPH
ETQSRQVRSCTKVIMQGMAVGRAVDLTRLHGYDDLRCKLEEMFDIQGELSASLKKWKVVY
TDDEDDMMLVGDDPWPEFCSMVKRIYIYTYEEAKQLTPKSKLPIIGDAIKPNRNKQSPES
DMPHSDLDSTAPVTDKDC
Download sequence
Identical sequences A0A0D3F6E9
OBART02G20600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]