SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART02G24860.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART02G24860.1
Domain Number 1 Region: 73-140
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.66e-17
Family B3 DNA binding domain 0.0018
Further Details:      
 
Weak hits

Sequence:  OBART02G24860.1
Domain Number - Region: 508-555
Classification Level Classification E-value
Superfamily Domain of early E2A DNA-binding protein, ADDBP 0.0994
Family Domain of early E2A DNA-binding protein, ADDBP 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART02G24860.1
Sequence length 599
Comment pep:novel chromosome:ABRL00000000:2:22089786:22092256:1 gene:OBART02G24860 transcript:OBART02G24860.1 description:""
Sequence
MITFADLAEPAPGAERCVDRQLWLACAGGMCTVPPVGAAVYYFPAGARRARARPRRAGAL
RGARPGARALPRRVRATVVAKDVHGVAWNFRHIYRGTPRRHLLTTGWSTFVNQKKLVAGD
SIVFLRGDGGDLHVGIRRAKRGFCGGGGGAEEASLPGWDQYGGLMRSNASPCAAAKGRGK
VRAEDVVEAARLASGGQPFEVVYYPRASTPEFCVRAAAVRAAMRVQWCPGMRFKMAFETE
DSSRISWFMGTVAGVQVVDPIRWPQSPWRLLQVTWDEPDLLQNVKRVSPWLVELVSSMPA
IHLSSFSPPRKKPRIPAYPEFPFEGQLLNPAFPPNPLAHGHHHYHHNHPSFFPFPDVSAP
AGIQGARHAQFGPSLSDLHLTHLQSSLMYPGLRRPDHVGPTPIPPPRISTDLTMGSSPPA
RALSMGAKKPDDAKPPGLMLFGQRILTERQMSLSGTTSPAATGNSSLNWNTEKGASEGSG
SGVIQNSPTDNTSSERLQWFRENSTVSELGLEPGQCKVFIESDTVGRNLDLSSLASFEQL
YGRLSEMFCIDSAELRSRVLYRGATGEVRHAGDEPFSEFIKLARRLTILTDAGSDNLGS
Download sequence
Identical sequences A0A0D3F7V6
OBART02G24860.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]