SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART03G26230.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART03G26230.1
Domain Number 1 Region: 22-121
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.61e-23
Family B3 DNA binding domain 0.0022
Further Details:      
 
Domain Number 2 Region: 1259-1357
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-22
Family B3 DNA binding domain 0.0032
Further Details:      
 
Domain Number 3 Region: 727-825
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.51e-19
Family B3 DNA binding domain 0.0021
Further Details:      
 
Domain Number 4 Region: 202-308
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.69e-18
Family B3 DNA binding domain 0.0053
Further Details:      
 
Domain Number 5 Region: 927-1031
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.85e-18
Family B3 DNA binding domain 0.0055
Further Details:      
 
Domain Number 6 Region: 400-497
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.27e-17
Family B3 DNA binding domain 0.012
Further Details:      
 
Domain Number 7 Region: 1144-1234
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000157
Family B3 DNA binding domain 0.005
Further Details:      
 
Domain Number 8 Region: 1482-1587
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000432
Family B3 DNA binding domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OBART03G26230.1
Sequence length 1594
Comment pep:novel chromosome:ABRL00000000:3:21665576:21682440:1 gene:OBART03G26230 transcript:OBART03G26230.1 description:""
Sequence
MAGSGSCMKKSCVCCQKYLEHLDGKMNCFVRRMTADSRRSMIMPCKFVNHFGGDFSGTIK
LQSPNGILYVVEVTKCKNKTVLRCGWEAFVDAHHIEENDSLLFRRVENSRFEVLIFDSDD
CEKNHQRVKDLLEIKREASAIVEKQQTWHLLLRIQAREDSPSEHESVESGDLETSQEPYV
LSRRSYLSEFQKDKVDALIQEIQPETTAFVAIMRKSNVQLPTPFLVISFCYAEVHFPHKS
VTVTLQRPCKSKKWHPRFYKRKDARMNILRGSWVEFVKDNRVQEQDICVFVPTKDARRNF
TFTVHLLRVAAAYSRGGTGVDRAGSSLGRTDVKSASEISIKEEPIDQEENVSSRNRNGVS
DESEEDEDSEGPAHPPYIVPCKSRLSRLQKKIVEEKVRSIQSKFPVYVAIMKKSNVERSA
SRCQLELGARFAAAVHLPDRRQTVVLQRRGERWATVMQIRSGTRRLLISGWHRFVRDNRL
RVGDICLFEFKTHERWRLTMATPNITTALASLSPGAAREATTRPPRLPHPYPLLRSASPS
PERPPAKPRGHKDGGGGVLLVSSRSGGLGSRPEWRRRCPPDPRRSGRIWRDGLAAGTGDG
GGRGELRRVVLWVMAAGMATSLGWRWWRSRIRRRRTRIRRRRGGRRWPEHAGTPRLPLAS
SGTPLDVGRRWWRGRRPDLAPCPDLARPRVGTGWLESGRRAGGVNIAGNTHRKKSCACCK
EYLEHLGGKMRCFLRRMAADSMHSMIMPDRFVSHFGGKIPGTIKLESPNGILYVVEVTEC
MNKTLLQCGWEAFVDAHNIKEGESLLFRHIENSRYEVLILDSDDCEKVFSCAGTRNGSCV
QDKTVDPVDSSGSSSNDTTQSSRSRNTENLTAMCSSSEKSGEDSPSGYEFHESVEPQTPS
GSDYVLSRRTYLSEAQKERVVAHIQDIQPEITVFVAVMKKCNLQSPAPYLVISSRYASVH
FPRETATITLQRPSKRKKWYPRFYKRIDKSDHMLRGQWQNFVHDNCLQEEDICLFVPTKG
GRNFVFTVHLLQAEATHSRDGTDVHKIGSSQNKRNSKMASQVHIKEAPGGDVSSESNKHG
VSHESLESEDSDGPSEPPYISSMRRRLSQLQKKTVEEKVRAIQSEIPICVATISKLAGSG
GKGKFRGLELSSRYAASYLPDKNHQTLVLQCKGMIWQINLVVLRRYTKGKRWFLTAGWRK
FAHDNRLRVGDFCLFELKKKKKLTMEVHIISNLQLHMAGGGSRMKKSCACCKRYLEHLGG
KMSCFLIRMTTDSMHSMIIPDRFVNHFGGKIPGTIKLESPNGILYVVEVTECMNKTVIQC
GWEAFVDAHHIKVGDSLLFRHIENSCFEVMILDSDGCERVFSCAGIKTSSSCVHDKTVDP
VDTSGRSSDDTAQPSRSERFARCQRDTSNDRRNTASLTAVSSSSEESENVSLKSNRNGVS
DESQESEDSEGPAGPPYILSWKSKSRLSSLQKKIIKEKVRSIQSEVPIYVAIMNKSNIGL
TSSPCQLELGARYAAAVHLPDRRQAVVLQRMGQRWDTVMQTKSGRCTTRRFLINGWRRFV
RDNRLCVGDICLLELKKHESKLTMTVHTIFSQQS
Download sequence
Identical sequences A0A0D3FLB9
OBART03G26230.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]