SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART03G26240.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART03G26240.1
Domain Number 1 Region: 242-335
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.63e-24
Family B3 DNA binding domain 0.0064
Further Details:      
 
Domain Number 2 Region: 25-123
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.49e-20
Family B3 DNA binding domain 0.0039
Further Details:      
 
Domain Number 3 Region: 409-516
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.51e-19
Family B3 DNA binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART03G26240.1
Sequence length 519
Comment pep:novel chromosome:ABRL00000000:3:21692154:21697002:1 gene:OBART03G26240 transcript:OBART03G26240.1 description:""
Sequence
MAGQGSQKKKSCDWSKRYVDHLNGKMKCFHLQMSANFGHSMTIPNKFLDHFGGTLSRTIE
LVSPKGIVYIVKVTEHMNKTILQCGWEAFVDAHHIEENDSLLFRHIENSRFEVLILDSDG
CEKVFTWAGIKKTSSVQERNVAPVDISRSTHDETTQSSGSKKFVRCQRASDSQRGKTAKL
AETSSSGESGEEGTDSSTFEDESSYELDDPQMPPGRNYVLSRWTSLSEAQEEKVDMLVQD
IQPEIPVFVAIMKHSNVNSRRACLVIPKRYASAHFPLESQTITLQRQGKNKKWYPMFYIR
KDGSGYMLYGCWKNFVRDNHVKEGDMCIFHLTKFTGGEFGATVHLLRETKSGSLGSFHTS
HKRFDLRDGRTWPKVTGARRVSSRPYLTADRVSLTEEQVRKVEEVVHSIQSEGPMYVSIM
NKSNVGTDGLYIIIFGRQFATRYLPEGEQTLTLLMTGKSNAWQVKMRPRSGDAQMITTGW
RHFVHDNHLQIEDICLFQLMNDESKLTMTVHIIRRNEKS
Download sequence
Identical sequences A0A0D3FLC0
OBART03G26240.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]