SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART03G26260.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART03G26260.1
Domain Number 1 Region: 89-189
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-22
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 292-393
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.76e-20
Family B3 DNA binding domain 0.007
Further Details:      
 
Domain Number 3 Region: 501-600
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.37e-19
Family B3 DNA binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART03G26260.1
Sequence length 603
Comment pep:novel chromosome:ABRL00000000:3:21702095:21707612:1 gene:OBART03G26260 transcript:OBART03G26260.1 description:""
Sequence
MTFSTPKLPLLSKSNQRLGQPRSLTWPWEVGNSSGEFVHQRAGKAQLLQRQISLQDDYSK
PRVHMAGQGSQMKKYCDCCKRYVDHSNGKMKCFHRQMSANFEHSMIIPNKFLDQFGGKIS
RTVELESPKGNVYVVKVSKHMNKTVLQCGWEAFVDAHQIEENDSLLFRHIENSRFTVLIL
DSNGCEKVFSCSGKRRASGVQERNADPIDVSSSTHDDTAQSSGGERFARSESGSDSQHRE
EAKESSSSEHESSYDLVDPQIAPMPGYVLSRGTNLSEAHEEKLDMLVQEIRPEIPLYVTT
MKHSNVNSHHASLVIAKHYACAYFPRTSQTITLKWHGKNRKWHPKFYIRKDQVGYILHGR
WIDFVRHNHVKEGDICIFHLKNFNGRKFRATVHLLRETIPHSFGALHIPKRFESRNGRMR
LKMTDDRRVSSTECRRGTMEPSTTNVKKEADNEQCNNGQGKRQEPLNFDVSVGSSKPYLT
ADRVSLTEEQFRKVEENVHSIQSEGPIYVSIMNKSNTLGRQFATRYLPEGEQTLTLLTTG
TGKAWQVKMRPRSGDARMFTLGWRDFVRDNRLQTEDICLFQLMKNSERGLAMTVHIIRHS
ERS
Download sequence
Identical sequences A0A0D3FLC2
OBART03G26260.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]