SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART03G26320.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART03G26320.1
Domain Number 1 Region: 18-116
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-25
Family B3 DNA binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 314-412
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.37e-23
Family B3 DNA binding domain 0.0021
Further Details:      
 
Domain Number 3 Region: 617-716
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.69e-22
Family B3 DNA binding domain 0.0017
Further Details:      
 
Domain Number 4 Region: 205-295
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.93e-22
Family B3 DNA binding domain 0.0043
Further Details:      
 
Domain Number 5 Region: 818-916
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.05e-18
Family B3 DNA binding domain 0.0068
Further Details:      
 
Domain Number 6 Region: 501-593
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000314
Family B3 DNA binding domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OBART03G26320.1
Sequence length 919
Comment pep:novel chromosome:ABRL00000000:3:21738605:21747542:1 gene:OBART03G26320 transcript:OBART03G26320.1 description:""
Sequence
MSKSGCERCRGRGFWDTDDQDTYFFKVMIGGFRRQMTIPYKFAENFRDQIQGTIKLKARN
GNTCSVLVEKCSNKLVLTKGWAEFANSHDIKMGDFLVFRYTGNSQFEVKIFDPSGCVKAA
SHNAVNIGQHAQNMQGDPIEILSCSDEHLRAQSLTTERQNQPEKDVIDNCNKKMKTEHAS
SSEDDQETPTAEVHRMKVEEMVRAIHSNHPVFVAVMKKSNVTRQPCYVAISRKYANEYFP
GGDQMLTLQRHGKRWQVKFCISKRKLRMLSKGWRKFTRDNELQVGDTCLFELLKNENPCG
QKMRKLNTRSTARDDQEKYFFKVMIGDFHKRMTIPDKFARHFKGVISKTIKLEPRSGYTF
DVQVTKKLNILVLGSGWESFVNAHDLNMGDFLVFKYNGDFLLQVLIFDPSGCEKSTSCSM
ENAIDHVGQGWKEHNDISTSYHDQPKGNKHWMQKDSSSKGNKIGNTRSSNTPSKFSGCIL
PRGTCLPVVQEKKMKEKIQAIHSKTPMYGNVMTKCNVSGSPCVLEITQLYDDAYLPFNNG
QELMLRHRDKSWKVRFYRFKNKSRKLTQGWKRFVHDNYLRMGDLCLFEILKNKYTMNMRR
PGARCREGHAHFNGNHIDGQYKNFFKVMIGRFRERMIIPNEFLQYFRGKIPRTIKLQLRD
GCTYDVQVTKNLGKISLQSGWKAFVTAHDLQMGDFLVFSYDGISKLKVLIFGPSGCEKVH
SRPTLKNATHCGEKWEEPLHISSNSHDLPVKSPQNVSKSEKQWDSSEQENDTANIEEVAL
QGDDLQGHPVLNCILPKHTRLTDMQKQQLESKVGAIHSEIPIYGCILRKSRVHGKSQTVD
ICREYADVYLPFKELNMTLQRHGKNWEVLCRTKDTRTKRLSTGWSRFAQENNLQVGDICL
FELLKKKEYSMNVHIIPKK
Download sequence
Identical sequences A0A0D3FLC9
OBART03G26320.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]