SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OBART03G26350.1 from Oryza barthii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OBART03G26350.1
Domain Number 1 Region: 28-128
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-23
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 247-340
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000179
Family B3 DNA binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OBART03G26350.1
Sequence length 376
Comment pep:novel chromosome:ABRL00000000:3:21770037:21772167:1 gene:OBART03G26350 transcript:OBART03G26350.1 description:""
Sequence
MGMLKIGKNCSVCKEWQEHCYWSHMADDCKHFLTYMVGDFTESMIVPSRFANNFNGHISE
VVNLKSPSGKTWSIGVANSDTGELVLRSGWKEFVDANGVQENDCLLFRYSGVSSFDVLIF
DPSGCEKASPHFVENRGFGREEKSAGAEGGGRDGDKNGHHQHQLEMTPHKNSSRCRSIPS
ACKRGLFSDEIEQDHREEKKEGDDEDEDEDKDGEDRYYFCRHGGRVTEYNLSKGDKEEIS
RVPVPVEPGNPVLVKVIHASHLLSSRYSTVGVSPEFAGRYLGPAMAREVVMERGGGGGGG
DQWHVRFVRRESSRGFHGTGWRRFARDNGLLAHDVCLFELRLVDGAGAGDRLRRRPRPTM
AVHVLRRVRGRFVLIR
Download sequence
Identical sequences A0A0D3FLD2
OBART03G26350.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]